PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g47367.1.p
Common NameBRADI_2g47367, LOC100842335
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 260aa    MW: 28373.7 Da    PI: 5.2193
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g47367.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-182976148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEdellv+ v++ G g+W+t +r+ g+ R++k+c++rw +yl
  Bradi2g47367.1.p 29 RGPWTAEEDELLVRFVEREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 76
                      89******************************99************97 PP

2Myb_DNA-binding44.63.3e-1487127648
                       HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +E++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Bradi2g47367.1.p  87 DDEEDLILRLHRVLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 127
                       68***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0252476IPR017930Myb domain
SuperFamilySSF466893.48E-2927123IPR009057Homeodomain-like
SMARTSM007171.1E-132878IPR001005SANT/Myb domain
PfamPF002491.6E-152976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-223083IPR009057Homeodomain-like
CDDcd001674.00E-123176No hitNo description
PROSITE profilePS5129424.05677131IPR017930Myb domain
SMARTSM007175.0E-1381129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2484132IPR009057Homeodomain-like
PfamPF002491.2E-1287127IPR001005SANT/Myb domain
CDDcd001673.57E-1187127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MARRKPPSQR GARRSAEGQS QSETATLKRG PWTAEEDELL VRFVEREGEG RWRTLPRRAG  60
LLRCGKSCRL RWMNYLRPDI KREPIADDEE DLILRLHRVL GNRWSLIAGR LPGRTDNEIK  120
NYWNSHLSKK LIAQGLDPRT HMPLAPADNA AAVVGPPDPA LPAQPTTAPS GAAGIGSGDS  180
TRASAAERGD DDQDQLAATM SLDDAAAQPL GFEGFADQFF AEHHAARGGF DDMGCAMVDA  240
DDAFALFLDS LVNESQFVD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28271315108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3765621e-149AK376562.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3127N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567025.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388502e-72MYB5_ARATH; Transcription repressor MYB5
TrEMBLI1HQN40.0I1HQN4_BRADI; Uncharacterized protein
STRINGBRADI2G47367.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-71myb domain protein 5